peptides.py is a pure-Python package to compute common descriptors for protein sequences

Last update: Dec 31, 2022

Related tags

Overview

`peptides.py`

Physicochemical properties and indices for amino-acid sequences.

🗺️ Overview

peptides.py is a pure-Python package to compute common descriptors for protein sequences. It is a port of Peptides, the R package written by Daniel Osorio for the same purpose. This library has no external dependency and is available for all modern Python versions (3.6+).

🔧 Installing

Install the peptides package directly from PyPi which hosts universal wheels that can be installed with pip:

$ pip install peptides

💡 Example

Start by creating a Peptide object from a protein sequence:

>>> import peptides
>>> peptide = peptides.Peptide("MLKKRFLGALAVATLLTLSFGTPVMAQSGSAVFTNEGVTPFAISYPGGGT")

Then use the appropriate methods to compute the descriptors you want:

>>> peptide.aliphatic_index()
89.8...
>>> peptide.boman()
-0.2097...
>>> peptide.charge(pH=7.4)
1.99199...
>>> peptide.isoelectric_point()
10.2436...

Methods that return more than one scalar value (for instance, Peptide.blosum_indices) will return a dedicated named tuple:

>>> peptide.ms_whim_scores()
MSWHIMScores(mswhim1=-0.436399..., mswhim2=0.4916..., mswhim3=-0.49200...)

Use the Peptide.descriptors method to get a dictionary with every available descriptor. This makes it very easy to create a pandas.DataFrame with descriptors for several protein sequences:

>> df = pandas.DataFrame([ peptides.Peptide(s).descriptors() for s in seqs ]) >>> df BLOSUM1 BLOSUM2 BLOSUM3 BLOSUM4 ... Z2 Z3 Z4 Z5 0 0.367000 -0.436000 -0.239 0.014500 ... -0.711000 -0.104500 -1.486500 0.429500 1 -0.697500 -0.372500 -0.493 0.157000 ... -0.307500 -0.627500 -0.450500 0.362000 2 0.479333 -0.001333 0.138 0.228667 ... -0.299333 0.465333 -0.976667 0.023333 [3 rows x 66 columns] ">

>>> seqs = ["SDKEVDEVDAALSDLEITLE", "ARQQNLFINFCLILIFLLLI", "EGVNDNECEGFFSAR"]
>>> df = pandas.DataFrame([ peptides.Peptide(s).descriptors() for s in seqs ])
>>> df
    BLOSUM1   BLOSUM2  BLOSUM3   BLOSUM4  ...        Z2        Z3        Z4        Z5
0  0.367000 -0.436000   -0.239  0.014500  ... -0.711000 -0.104500 -1.486500  0.429500
1 -0.697500 -0.372500   -0.493  0.157000  ... -0.307500 -0.627500 -0.450500  0.362000
2  0.479333 -0.001333    0.138  0.228667  ... -0.299333  0.465333 -0.976667  0.023333

[3 rows x 66 columns]

💭 Feedback

⚠️ Issue Tracker

Found a bug ? Have an enhancement request ? Head over to the GitHub issue tracker if you need to report or ask something. If you are filing in on a bug, please include as much information as you can about the issue, and try to recreate the same bug in a simple, easily reproducible situation.

🏗️ Contributing

Contributions are more than welcome! See CONTRIBUTING.md for more details.

⚖️ License

This library is provided under the GNU General Public License v3.0. The original R Peptides package was written by Daniel Osorio, Paola Rondón-Villarreal and Rodrigo Torres, and is licensed under the terms of the GPLv2.

This project is in no way not affiliated, sponsored, or otherwise endorsed by the original Peptides authors. It was developed by Martin Larralde during his PhD project at the European Molecular Biology Laboratory in the Zeller team.

You might also like...

Python Package for DataHerb: create, search, and load datasets.

The Python Package for DataHerb A DataHerb Core Service to Create and Load Datasets.

4 Feb 11, 2022

wikirepo is a Python package that provides a framework to easily source and leverage standardized Wikidata information

Python based Wikidata framework for easy dataframe extraction wikirepo is a Python package that provides a framework to easily source and leverage sta

35 Jan 4, 2023

Python package for processing UC module spectral data.

UC Module Python Package How To Install clone repo. cd UC-module pip install . How to Use uc.module.UC(measurment=str, dark=str, reference=str, heade

1 Oct 20, 2021

sportsdataverse python package

sportsdataverse-py See CHANGELOG.md for details. The goal of sportsdataverse-py is to provide the community with a python package for working with spo

37 Dec 27, 2022

PyEmits, a python package for easy manipulation in time-series data.

PyEmits, a python package for easy manipulation in time-series data. Time-series data is very common in real life. Engineering FSI industry (Financial

5 Sep 23, 2022

Retail-Sim is python package to easily create synthetic dataset of retaile store.

Retailer's Sale Data Simulation Retail-Sim is python package to easily create synthetic dataset of retaile store. Simulation Model Simulator consists

7 Sep 30, 2022

A python package which can be pip installed to perform statistics and visualize binomial and gaussian distributions of the dataset

GBiStat package A python package to assist programmers with data analysis. This package could be used to plot : Binomial Distribution of the dataset p

4 Oct 17, 2022

VevestaX is an open source Python package for ML Engineers and Data Scientists.

VevestaX Track failed and successful experiments as well as features. VevestaX is an open source Python package for ML Engineers and Data Scientists.

24 Dec 14, 2022

nrgpy is the Python package for processing NRG Data Files

nrgpy nrgpy is the Python package for processing NRG Data Files Website and source: https://github.com/nrgpy/nrgpy Documentation: https://nrgpy.github

23 Dec 8, 2022

Comments

Per-residue data

It seems that the API can only output single statistics for the entire peptide chain, but I'm interested in statistics for each residue individually. I'm wondering if it might be possible to output an array/list from some of these functions instead of always averaging them as is done now.
enhancement

opened by multimeric 1

Hydrophobic moment is inconsistent with R version

Computed hydrophobic moment is not the same as the one computed by R. More specifically, it seems that peptides.py always outputs 0 for the hydrophobic moment when peptide length is shorter than the set window. The returned value matches the value from R when peptide length is equal to or greater than the set window length.

Example in python:

>>> import peptides`
>>> peptides.Peptide("MLK").hydrophobic_moment(window=5, angle=100)
0.0
>>> peptides.Peptide("AACQ").hydrophobic_moment(window=5, angle=100)
0.0
>>> peptides.Peptide("FGGIQ").hydrophobic_moment(window=5, angle=100)
0.31847187610377536

Example in R:

> library(Peptides)
> hmoment(seq="MLK", window=5, angle=100)
[1] 0.8099386
> hmoment(seq="AACQ", window=5, angle=100)
[1] 0.3152961
> hmoment(seq="FGGIQ", window=5, angle=100)
[1] 0.3184719

I think that it can be easily fixed by internally setting the window length to the length of the peptide if the latter is shorter. What I propose:

--- a/peptides/__init__.py
+++ b/peptides/__init__.py
@@ -657,6 +657,7 @@ class Peptide(typing.Sequence[str]):
               :doi:`10.1073/pnas.81.1.140`. :pmid:`6582470`.

         """
+        window = min(window, len(self))
         scale = tables.HYDROPHOBICITY["Eisenberg"]
         lut = [scale.get(aa, 0.0) for aa in self._CODE1]
         angles = [(angle * i) % 360 for i in range(window)]

bug

opened by eotovic 1

RuntimeWarning in auto_correlation function()
Hi, thank you for creating peptides.py.

Some hydrophobicity tables together with certain proteins cause a runtime warning for in the function auto_correlation():

import peptides for hydro in peptides.tables.HYDROPHOBICITY.keys(): print(hydro) table = peptides.tables.HYDROPHOBICITY[hydro] peptides.Peptide('MANTQNISIWWWAR').auto_correlation(table)

Warning (s2 == 0):

RuntimeWarning: invalid value encountered in double_scalars return s1 / s2

The tables concerned are: octanolScale_pH2, interfaceScale_pH2, oiScale_pH2 Some other proteins causing the same warning: ['MSYGGSCAGFGGGFALLIVLFILLIIIGCSCWGGGGYGY', 'MFILLIIIGASCFGGGGGCGYGGYGGYAGGYGGYCC', 'MSFGGSCAGFGGGFALLIVLFILLIIIGCSCWGGGGGF']
opened by jhahnfeld 0

Releases(v0.3.1)

v0.3.1(Sep 1, 2022)
Fixed

peptides.datasets data files missing from the source distribution.

Source code(tar.gz)
Source code(zip)
v0.3.0(Sep 1, 2022)
Added

Peptide.linker_preference_profile to build a profile like used in the DomCut method from Suyama & Ohara (2002).

Peptide.profile to build a generic per-residue profile from a data table (#3).

Source code(tar.gz)
Source code(zip)
v0.2.0(Oct 25, 2021)
Added

Peptide.counts method to get the number of occurences of each amino acid in the peptide.

Peptide.frequencies to get the frequencies of each amino acid in the peptide.

Peptide.pcp_descriptors to compute the PCP descriptors from Mathura & Braun (2001).

Peptide.sneath_vectors to compute the descriptors from Sneath (1966).

Hydrophilicity descriptors from Barley (2018).

Peptide.structural_class to predict the structural class of a protein using one of three reference datasets and one of four distance metrics.

Changed

Peptide.aliphatic_index now supports unknown Leu/Ile residue (code J).

Swap order of Peptide.hydrophobic_moment arguments for consistency with profile methods.

Some Peptide functions now support vectorized code using numpy if available.

Source code(tar.gz)
Source code(zip)
v0.1.0(Oct 21, 2021)

Initial release.
Source code(tar.gz)
Source code(zip)

Owner

Martin Larralde

PhD candidate in Bioinformatics, passionate about programming, Pythonista, Rustacean. I write poems, and sometimes they are executable.

GitHub Repository

Parses data out of your Google Takeout (History, Activity, Youtube, Locations, etc...)

google_takeout_parser parses both the Historical HTML and new JSON format for Google Takeouts caches individual takeout results behind cachew merge mu

27 Dec 28, 2022

Used for data processing in machine learning, and help us to construct ML model more easily from scratch

Used for data processing in machine learning, and help us to construct ML model more easily from scratch. Can be used in linear model, logistic regression model, and decision tree.

0 Jul 05, 2022

Get mutations in cluster by querying from LAPIS API

Cluster Mutation Script Get mutations appearing within user-defined clusters. Usage Clusters are defined in the clusters dict in main.py: clusters = {

1 Oct 22, 2021

Flenser is a simple, minimal, automated exploratory data analysis tool.

Flenser Have you ever been handed a dataset you've never seen before? Flenser is a simple, minimal, automated exploratory data analysis tool. It runs

79 Sep 20, 2022

WithPipe is a simple utility for functional piping in Python.

A utility for functional piping in Python that allows you to access any function in any scope as a partial.

1 Oct 26, 2021

Show you how to integrate Zeppelin with Airflow

Introduction This repository is to show you how to integrate Zeppelin with Airflow. The philosophy behind the ingtegration is to make the transition f

11 Dec 30, 2022

Catalogue data - A Python Scripts to prepare catalogue data

catalogue_data Scripts to prepare catalogue data. Setup Clone this repo. Install

3 Mar 03, 2022

pyETT: Python library for Eleven VR Table Tennis data

pyETT: Python library for Eleven VR Table Tennis data Documentation Documentation for pyETT is located at https://pyett.readthedocs.io/. Installation

5 Nov 19, 2022

Pyspark project that able to do joins on the spark data frames.

SPARK JOINS This project is to perform inner, all outer joins and semi joins. create_df.py: load_data.py : helps to put data into Spark data frames. d

1 Dec 14, 2021

🌍 Create 3d-printable STLs from satellite elevation data 🌏

mapa 🌍 Create 3d-printable STLs from satellite elevation data Installation pip install mapa Usage mapa uses numpy and numba under the hood to crunch

13 Dec 15, 2022

Cold Brew: Distilling Graph Node Representations with Incomplete or Missing Neighborhoods

Cold Brew: Distilling Graph Node Representations with Incomplete or Missing Neighborhoods Introduction Graph Neural Networks (GNNs) have demonstrated

37 Dec 15, 2022

Sentiment analysis on streaming twitter data using Spark Structured Streaming & Python

Sentiment analysis on streaming twitter data using Spark Structured Streaming & Python This project is a good starting point for those who have little

2 Dec 04, 2021

The Spark Challenge Student Check-In/Out Tracking Script

The Spark Challenge Student Check-In/Out Tracking Script This Python Script uses the Student ID Database to match the entries with the ID Card Swipe a

1 Dec 09, 2021

Code for the DH project "Dhimmis & Muslims – Analysing Multireligious Spaces in the Medieval Muslim World"

Damast This repository contains code developed for the digital humanities project "Dhimmis & Muslims – Analysing Multireligious Spaces in the Medieval

2 Jul 01, 2022

Includes all files needed to satisfy hw02 requirements

HW 02 Data Sets Mean Scale Score for Asian and Hispanic Students, Grades 3 - 8 This dataset provides insights into the New York City education system

7 Oct 28, 2021

EOD Historical Data Python Library (Unofficial)

EOD Historical Data Python Library (Unofficial) https://eodhistoricaldata.com Installation python3 -m pip install eodhistoricaldata Note Demo API key

20 Dec 22, 2022

Uses MIT/MEDSL, New York Times, and US Census datasources to analyze per-county COVID-19 deaths.

Covid County Executive summary Setup Install miniconda, then in the command line, run conda create -n covid-county conda activate covid-county conda i

1 Dec 22, 2021

Data Analytics on Genomes and Genetics

Data Analytics performed on On genomes and Genetics dataset to predict genetic disorder and disorder subclass. DONE by TEAM SIGMA!

1 Jan 12, 2022

2019 Data Science Bowl

Kaggle-2019-Data-Science-Bowl-Solution - Here i present my solution to kaggle 2019 data science bowl and how i improved it to win a silver medal in that competition.

1 Jan 01, 2022

In this tutorial, raster models of soil depth and soil water holding capacity for the United States will be sampled at random geographic coordinates within the state of Colorado.

Raster_Sampling_Demo (Resulting graph of this demo) Background Sampling values of a raster at specific geographic coordinates can be done with a numbe

2 Dec 13, 2022