A fast and easy to use, moddable, Python based Minecraft server!

Related tags

Deep Learningpythonminecraftserverasyncminecraft-serverpluginsasynciopymcmcmc-serverminecraftserverjava-editionmcjeplugins-apimcserverpyminepythonminepythonminecraftmcpyasync-networking
Overview

PyMine

discord views quality contributors code size build status code style

PyMine - The fastest, easiest to use, Python-based Minecraft Server!

Features

Note: This list is not always up to date, and doesn't contain all the features that PyMine offers

  • Joinable - the login process is complete, but users can not yet join the world
  • Packet Models - missing some clientbound packets
  • Status + Login Logic - completed
  • Play Logic - currently a work in progress
  • World Generation - superflat world generation has been started
  • Entities/Entity AI - not started yet
  • Plugin API - completed, but more will be added as the development continues
  • Command/Argument Parsing - currently a work in progress
  • Query Support - completed
  • RCON Support - not started yet

Contributing

Installation / Usage

Check out the docs for more info

Installing from source

  • First, clone the repository git clone https://github.com/py-mine/PyMine.git and move into that directory (cd PyMine)
  • Next, install the required Python packages via pip (python3 -m pip install -r requirements.txt)
  • To run the server, you should run python3 pymine.
  • It is recommended you do not use regular Python, but PyPy3

API/Plugin Examples

Contributors ✨

Thanks goes to these wonderful people (emoji key):


Milo Weinberg
πŸ’» 🎨 πŸ”Œ πŸ”£ πŸ§‘β€πŸ« πŸ“– πŸ’¬ πŸ› πŸ’‘ πŸ€” πŸ“† πŸ‘€ ⚠️
Sh-wayz
πŸ’» πŸ› πŸ“– πŸ’‘ πŸ’¬ πŸ‘€ ⚠️ πŸ“†
Ammar-sys
πŸ“–
Treyver Reicha
πŸ’» πŸ‘€ πŸ€” πŸ› πŸ“† ⚠️
Paul Przybyszewski
πŸ’»
Ashwin Vinod
πŸ€” πŸ’» πŸ“–
imSofi
πŸ›

Kevin Thomas
πŸ€”
Milan Mehra
πŸ€”

This project follows the all-contributors specification. Contributions of any kind welcome!

Owner
PyMine
PyMine
GitHub Repository
Deduplicating Training Data Makes Language Models Better

Deduplicating Training Data Makes Language Models Better This repository contains code to deduplicate language model datasets as descrbed in the paper

Google Research 431 Dec 27, 2022
Implementation of STAM (Space Time Attention Model), a pure and simple attention model that reaches SOTA for video classification

STAM - Pytorch Implementation of STAM (Space Time Attention Model), yet another pure and simple SOTA attention model that bests all previous models in

Phil Wang 109 Dec 28, 2022
A custom-designed Spider Robot trained to walk using Deep RL in a PyBullet Simulation

SpiderBot_DeepRL Title: Implementation of Single and Multi-Agent Deep Reinforcement Learning Algorithms for a Walking Spider Robot Authors(s): Arijit

Arijit Dasgupta 9 Jul 28, 2022
Generate image analogies using neural matching and blending

neural image analogies This is basically an implementation of this "Image Analogies" paper, In our case, we use feature maps from VGG16. The patch mat

Adam Wentz 3.5k Jan 08, 2023
Implementation of NÜWA, state of the art attention network for text to video synthesis, in Pytorch

NÜWA - Pytorch (wip) Implementation of NÜWA, state of the art attention network for text to video synthesis, in Pytorch. This repository will be popul

Phil Wang 463 Dec 28, 2022
Mix3D: Out-of-Context Data Augmentation for 3D Scenes (3DV 2021)

Mix3D: Out-of-Context Data Augmentation for 3D Scenes (3DV 2021) Alexey Nekrasov*, Jonas Schult*, Or Litany, Bastian Leibe, Francis Engelmann Mix3D is

Alexey Nekrasov 189 Dec 26, 2022
PrimitiveNet: Primitive Instance Segmentation with Local Primitive Embedding under Adversarial Metric (ICCV 2021)

PrimitiveNet Source code for the paper: Jingwei Huang, Yanfeng Zhang, Mingwei Sun. [PrimitiveNet: Primitive Instance Segmentation with Local Primitive

Jingwei Huang 47 Dec 06, 2022
It is a system used to detect bone fractures. using techniques deep learning and image processing

MohammedHussiengadalla-Intelligent-Classification-System-for-Bone-Fractures It is a system used to detect bone fractures. using techniques deep learni

Mohammed Hussien 7 Nov 11, 2022
Accommodating supervised learning algorithms for the historical prices of the world's favorite cryptocurrency and boosting it through LightGBM.

Accommodating supervised learning algorithms for the historical prices of the world's favorite cryptocurrency and boosting it through LightGBM.

1 Nov 27, 2021
γ€ŠTowards High Fidelity Face Relighting with Realistic Shadows》(CVPR 2021)

Towards High Fidelity Face-Relighting with Realistic Shadows Andrew Hou, Ze Zhang, Michel Sarkis, Ning Bi, Yiying Tong, Xiaoming Liu. In CVPR, 2021. T

114 Dec 10, 2022
Selecting Parallel In-domain Sentences for Neural Machine Translation Using Monolingual Texts

DataSelection-NMT Selecting Parallel In-domain Sentences for Neural Machine Translation Using Monolingual Texts Quick update: The paper got accepted o

Javad Pourmostafa 6 Jan 07, 2023
Image-to-Image Translation in PyTorch

CycleGAN and pix2pix in PyTorch New: Please check out contrastive-unpaired-translation (CUT), our new unpaired image-to-image translation model that e

Jun-Yan Zhu 19k Jan 07, 2023
Implementation of the master's thesis "Temporal copying and local hallucination for video inpainting".

Temporal copying and local hallucination for video inpainting This repository contains the implementation of my master's thesis "Temporal copying and

David Álvarez de la Torre 1 Dec 02, 2022
A robust pointcloud registration pipeline based on correlation.

PHASER: A Robust and Correspondence-Free Global Pointcloud Registration Ubuntu 18.04+ROS Melodic: Overview Pointcloud registration using correspondenc

ETHZ ASL 101 Dec 01, 2022
Alphabetical Letter Recognition

DecisionTrees-Image-Classification Alphabetical Letter Recognition In these demo we are using "Decision Trees" Our database is composed by Learning Im

Mohammed Firass 4 Nov 30, 2021
Nested cross-validation is necessary to avoid biased model performance in embedded feature selection in high-dimensional data with tiny sample sizes

Pruner for nested cross-validation - Sphinx-Doc Nested cross-validation is necessary to avoid biased model performance in embedded feature selection i

1 Dec 15, 2021
Vector AI β€” A platform for building vector based applications. Encode, query and analyse data using vectors.

Vector AI is a framework designed to make the process of building production grade vector based applications as quickly and easily as possible. Create

Vector AI 267 Dec 23, 2022
A curated list of awesome deep long-tailed learning resources.

A curated list of awesome deep long-tailed learning resources.

vanint 210 Dec 25, 2022
[NeurIPS 2020] Code for the paper "Balanced Meta-Softmax for Long-Tailed Visual Recognition"

Balanced Meta-Softmax Code for the paper Balanced Meta-Softmax for Long-Tailed Visual Recognition Jiawei Ren, Cunjun Yu, Shunan Sheng, Xiao Ma, Haiyu

Jiawei Ren 65 Dec 21, 2022
PyTorch code for the paper "FIERY: Future Instance Segmentation in Bird's-Eye view from Surround Monocular Cameras"

FIERY This is the PyTorch implementation for inference and training of the future prediction bird's-eye view network as described in: FIERY: Future In

Wayve 406 Dec 24, 2022